PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 490555
Common NameARALYDRAFT_490555
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family GRAS
Protein Properties Length: 558aa    MW: 61124.1 Da    PI: 5.8602
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
490555genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS325.79.2e-1002065533374
    GRAS   3 elLlecAeavssgdlelaqalLarlsel.aspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNqaIle 104
             e+L+++Ae+++s d+ laq +Larl+++ +sp g+p++R+a+yf+eAL++ l++          +++ ++++ + ++aa+k fse+sP+l+f+++t Nqa+le
  490555 206 EQLVKAAEVIES-DTCLAQGILARLNQQlSSPVGKPLERAAFYFKEALNNLLHN---------VSQTLNPYSLIFKIAAYKSFSEISPVLQFANFTSNQALLE 298
             79******8887.9************998************************9.........55566667789***************************** PP

    GRAS 105 avegeervHiiDfdisqGlQWpaLlqaLasRpegpp.slRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledl.eleeLrvkpgEalaVn 205
             +++g +r+Hi+Dfdi++G+QW++L+q+L  R++ +p sl+iT+++sp+++++ el  t+++L++fA+e++++++++vl   +l+ l +++  + +++Ea+aVn
  490555 299 SFHGFHRLHIVDFDIGYGGQWASLMQELVLRDNAAPlSLKITVLASPANHDQLELGFTQDNLKHFASEINISLDIQVL---SLDLLgSISWPNSSEKEAVAVN 398
             ********************************99998****************************************8...555552233335667******* PP

    GRAS 206 lvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrer 308
             ++ + ++ l          + vL++vk+lsP+++v++++ +++++ +F ++++++l+ ++al++sl+a   ++ ++++k+Er+l+++ei+++v  + ++    
  490555 399 ISAASFSHL----------PLVLRFVKHLSPTIIVCSDRGCERTDLPFPQQVAHSLHSHAALLESLDAV-NANLDAMQKIERFLIQPEIEKLVLDRSRS---I 487
             ***988887..........67*********************************************887.56779*******************99998...5 PP

    GRAS 309 hetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
             ++ +++W+ ++ ++GF pv+ s+++++qa++l+++++++g++ve++++sl+l+W++ +Lv vSaWr
  490555 488 ERPMMTWQTMFLQMGFLPVTHSNFTESQAECLVQRTPVRGFHVEKKHNSLILCWQRTELVGVSAWR 553
             5567*************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098540.721178533IPR005202Transcription factor GRAS
PfamPF035143.2E-97206553IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007623Biological Processcircadian rhythm
GO:0048768Biological Processroot hair cell tip growth
GO:0051301Biological Processcell division
Sequence ? help Back to Top
Protein Sequence    Length: 558 aa     Download sequence    Send to blast
MPLPFEAFQG KGISCFSSFS SSFPQPLSPL LSRRKVRGGE EEEEEEVPAA EPTSVLDVLI  60
SPTSSSTVSS SHGGNSAVGG GGDATTDEQC GTIGLGDWEQ VPHDHEQSIL RLIMGESTDP  120
SLELNSILQT SPTFHDSDYS SPGFGVVDTG FGLDHHSVPP SHVPGLLISQ SQTHYTQNPA  180
AIFYGHHHHT PPPAKRLNPG PVGIAEQLVK AAEVIESDTC LAQGILARLN QQLSSPVGKP  240
LERAAFYFKE ALNNLLHNVS QTLNPYSLIF KIAAYKSFSE ISPVLQFANF TSNQALLESF  300
HGFHRLHIVD FDIGYGGQWA SLMQELVLRD NAAPLSLKIT VLASPANHDQ LELGFTQDNL  360
KHFASEINIS LDIQVLSLDL LGSISWPNSS EKEAVAVNIS AASFSHLPLV LRFVKHLSPT  420
IIVCSDRGCE RTDLPFPQQV AHSLHSHAAL LESLDAVNAN LDAMQKIERF LIQPEIEKLV  480
LDRSRSIERP MMTWQTMFLQ MGFLPVTHSN FTESQAECLV QRTPVRGFHV EKKHNSLILC  540
WQRTELVGVS AWRCRSS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A8e-322045534375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF4628310.0AF462831.1 Arabidopsis thaliana AT4g00150/F6N15_20 mRNA, complete cds.
GenBankAK1172980.0AK117298.1 Arabidopsis thaliana mRNA, clone: RAFL16-86-D11.
GenBankAL1614710.0AL161471.2 Arabidopsis thaliana DNA chromosome 4, contig fragment No. 1.
GenBankAY1335370.0AY133537.1 Arabidopsis thaliana At4g00150/F6N15_20 mRNA, complete cds.
GenBankCP0026870.0CP002687.1 Arabidopsis thaliana chromosome 4 sequence.
GenBankF6N150.0AF069299.1 Arabidopsis thaliana BAC F6N15.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002872967.10.0hypothetical protein ARALYDRAFT_490555
SwissprotO813160.0SCL6_ARATH; Scarecrow-like protein 6
TrEMBLD7M5S20.0D7M5S2_ARALL; Putative uncharacterized protein
STRINGfgenesh2_kg.6__3689__AT4G00150.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM85742739
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00150.10.0GRAS family protein